Brand: | Abnova |
Reference: | H00002146-M01 |
Product name: | EZH2 monoclonal antibody (M01), clone 2C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EZH2. |
Clone: | 2C3 |
Isotype: | IgG2b Kappa |
Gene id: | 2146 |
Gene name: | EZH2 |
Gene alias: | ENX-1|EZH1|KMT6|MGC9169 |
Gene description: | enhancer of zeste homolog 2 (Drosophila) |
Genbank accession: | BC010858 |
Immunogen: | EZH2 (AAH10858, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIM |
Protein accession: | AAH10858 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | EZH2 monoclonal antibody ( M01 ) , clone 2C3 recognizes the appropriate size ( 95 KDa ) full length protein in human prostrate cancer cells ( DU145, whole cell extract made in modified RIPA buffer ) , Primary Ab dilution = 1 : 1000. Mouse-HRPO dilution = 1 : 25000. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |