| Brand: | Abnova |
| Reference: | H00002138-A01 |
| Product name: | EYA1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant EYA1. |
| Gene id: | 2138 |
| Gene name: | EYA1 |
| Gene alias: | BOP|BOR|MGC141875 |
| Gene description: | eyes absent homolog 1 (Drosophila) |
| Genbank accession: | NM_000503 |
| Immunogen: | EYA1 (NP_000494, 100 a.a. ~ 170 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSF |
| Protein accession: | NP_000494 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.92 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EYA1 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of EYA1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Eyes absent 1 (Eya1) is a critical coordinator of epithelial, mesenchymal and vascular morphogenesis in the mammalian lung.El-Hashash AH, Al Alam D, Turcatel G, Bellusci S, Warburton D. Dev Biol. 2011 Feb 1;350(1):112-26. Epub 2010 Dec 1. |