Cart 56 Product Products 18 540,32 € (empty)
No products
To be determined Shipping
18 540,32 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 56 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 18 540,32 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 18 540,32 €
Data sheet of EXT2 monoclonal antibody (M01), clone 3G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about EXT2 monoclonal antibody (M01), clone 3G6
| Brand: | Abnova |
| Reference: | H00002132-M01 |
| Product name: | EXT2 monoclonal antibody (M01), clone 3G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EXT2. |
| Clone: | 3G6 |
| Isotype: | IgG1 kappa |
| Gene id: | 2132 |
| Gene name: | EXT2 |
| Gene alias: | SOTV |
| Gene description: | exostoses (multiple) 2 |
| Genbank accession: | BC010058 |
| Immunogen: | EXT2 (AAH10058, 216 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GFSTWTYRQGYDVSIPVYSPLSAEVDLPEKGPGPRQYFLLSSQVGLHPEYREDLEALQVKHGESVLVLDKCTNLSEGVLSVRKRCHKHQVFDYPQVLQEA |
| Protein accession: | AAH10058 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged EXT2 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |