Brand: | Abnova |
Reference: | H00002131-M01 |
Product name: | EXT1 monoclonal antibody (M01), clone 5A5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EXT1. |
Clone: | 5A5 |
Isotype: | IgG2a kappa |
Gene id: | 2131 |
Gene name: | EXT1 |
Gene alias: | EXT|LGCR|LGS|TRPS2|ttv |
Gene description: | exostosin 1 |
Genbank accession: | BC001174 |
Immunogen: | EXT1 (AAH01174, 246 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGRRLGSF |
Protein accession: | AAH01174 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EXT1 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |