View larger

EWSR1 monoclonal antibody (M01), clone 5C10

Reference:

Condition: New product

Data sheet of EWSR1 monoclonal antibody (M01), clone 5C10

Brand:	Abnova
Reference:	H00002130-M01
Product name:	EWSR1 monoclonal antibody (M01), clone 5C10
Product description:	Mouse monoclonal antibody raised against a partial recombinant EWSR1.
Clone:	5C10
Isotype:	IgG2a Kappa
Gene id:	2130
Gene name:	EWSR1
Gene alias:	EWS
Gene description:	Ewing sarcoma breakpoint region 1
Genbank accession:	NM_005243
Immunogen:	EWSR1 (NP_005234, 358 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS
Protein accession:	NP_005234
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.3 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Immunoperoxidase of monoclonal antibody to EWSR1 on formalin-fixed paraffin-embedded human urinary bladder. [antibody concentration 3 ug/ml]
Applications:	IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition:	Dry Ice