EVX1 monoclonal antibody (M04), clone 3F4 View larger

EVX1 monoclonal antibody (M04), clone 3F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EVX1 monoclonal antibody (M04), clone 3F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about EVX1 monoclonal antibody (M04), clone 3F4

Brand: Abnova
Reference: H00002128-M04
Product name: EVX1 monoclonal antibody (M04), clone 3F4
Product description: Mouse monoclonal antibody raised against a partial recombinant EVX1.
Clone: 3F4
Isotype: IgG2a Kappa
Gene id: 2128
Gene name: EVX1
Gene alias: -
Gene description: even-skipped homeobox 1
Genbank accession: NM_001989
Immunogen: EVX1 (NP_001980, 2 a.a. ~ 110 a.a)partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQP
Protein accession: NP_001980
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002128-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002128-M04-1-1-1.jpg
Application image note: EVX1 monoclonal antibody (M04), clone 3F4 Western Blot analysis of EVX1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EVX1 monoclonal antibody (M04), clone 3F4 now

Add to cart