EVI2B monoclonal antibody (M02), clone 2G9 View larger

EVI2B monoclonal antibody (M02), clone 2G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EVI2B monoclonal antibody (M02), clone 2G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about EVI2B monoclonal antibody (M02), clone 2G9

Brand: Abnova
Reference: H00002124-M02
Product name: EVI2B monoclonal antibody (M02), clone 2G9
Product description: Mouse monoclonal antibody raised against a partial recombinant EVI2B.
Clone: 2G9
Isotype: IgG2b Kappa
Gene id: 2124
Gene name: EVI2B
Gene alias: D17S376|EVDB
Gene description: ecotropic viral integration site 2B
Genbank accession: NM_006495
Immunogen: EVI2B (NP_006486, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAV
Protein accession: NP_006486
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002124-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002124-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged EVI2B is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EVI2B monoclonal antibody (M02), clone 2G9 now

Add to cart