EVC monoclonal antibody (M06), clone 3C4 View larger

EVC monoclonal antibody (M06), clone 3C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EVC monoclonal antibody (M06), clone 3C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about EVC monoclonal antibody (M06), clone 3C4

Brand: Abnova
Reference: H00002121-M06
Product name: EVC monoclonal antibody (M06), clone 3C4
Product description: Mouse monoclonal antibody raised against a partial recombinant EVC.
Clone: 3C4
Isotype: IgG2a Kappa
Gene id: 2121
Gene name: EVC
Gene alias: DWF-1|EVC1|EVCL|MGC105107
Gene description: Ellis van Creveld syndrome
Genbank accession: NM_014556
Immunogen: EVC (NP_055371, 493 a.a. ~ 602 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VLERQRLMQCDLEEEENVRATEAVVALCQELYFSTVDTFQKFVDALFLQTLPGMTGLPPEECDYLRQEVQENAAWQLGKSNRFRRQQWKLFQELLEQDQQVWMEECALSS
Protein accession: NP_055371
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002121-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002121-M06-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged EVC is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EVC monoclonal antibody (M06), clone 3C4 now

Add to cart