Cart 23 Product Products 7 180,75 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-El...259,07 € -
-
-
No products
To be determined Shipping
7 180,75 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 23 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 7 180,75 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 7 180,75 €
Data sheet of ETV5 monoclonal antibody (M02), clone 7C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about ETV5 monoclonal antibody (M02), clone 7C10
| Brand: | Abnova |
| Reference: | H00002119-M02 |
| Product name: | ETV5 monoclonal antibody (M02), clone 7C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ETV5. |
| Clone: | 7C10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2119 |
| Gene name: | ETV5 |
| Gene alias: | ERM |
| Gene description: | ets variant 5 |
| Genbank accession: | NM_004454 |
| Immunogen: | ETV5 (NP_004445, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPM |
| Protein accession: | NP_004445 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | ETV5 monoclonal antibody (M02), clone 7C10 Western Blot analysis of ETV5 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor.Lu G, Zhang Q, Huang Y, Song J, Tomaino R, Ehrenberger T, Lim E, Liu W, Bronson RT, Bowden M, Brock J, Krop IE, Dillon DA, Gygi SP, Mills GB, Richardson AL, Signoretti S, Yaffe MB, Kaelin WG Jr Cancer Cell. 2014 Aug 11;26(2):222-34. doi: 10.1016/j.ccr.2014.06.026. |