Brand: | Abnova |
Reference: | H00002117-M02 |
Product name: | ETV3 monoclonal antibody (M02), clone 1C11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ETV3. |
Clone: | 1C11 |
Isotype: | IgG2b Kappa |
Gene id: | 2117 |
Gene name: | ETV3 |
Gene alias: | METS|PE-1|PE1|bA110J1.4 |
Gene description: | ets variant 3 |
Genbank accession: | BC022868 |
Immunogen: | ETV3 (AAH22868, 1 a.a. ~ 143 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGKIQTLLVGN |
Protein accession: | AAH22868 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ETV3 is 10 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |