Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 917,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 917,00 €
Data sheet of ETV3 monoclonal antibody (M02), clone 1C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about ETV3 monoclonal antibody (M02), clone 1C11
| Brand: | Abnova |
| Reference: | H00002117-M02 |
| Product name: | ETV3 monoclonal antibody (M02), clone 1C11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ETV3. |
| Clone: | 1C11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2117 |
| Gene name: | ETV3 |
| Gene alias: | METS|PE-1|PE1|bA110J1.4 |
| Gene description: | ets variant 3 |
| Genbank accession: | BC022868 |
| Immunogen: | ETV3 (AAH22868, 1 a.a. ~ 143 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGKIQTLLVGN |
| Protein accession: | AAH22868 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ETV3 is 10 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |