Cart 46 Product Products 15 658,84 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-El...259,07 € -
-
-
-
-
1 x EphA3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
15 658,84 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 46 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 15 658,84 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 15 658,84 €
Data sheet of ETV1 monoclonal antibody (M02), clone 4C12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about ETV1 monoclonal antibody (M02), clone 4C12
| Brand: | Abnova |
| Reference: | H00002115-M02 |
| Product name: | ETV1 monoclonal antibody (M02), clone 4C12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ETV1. |
| Clone: | 4C12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2115 |
| Gene name: | ETV1 |
| Gene alias: | DKFZp781L0674|ER81|MGC104699|MGC120533|MGC120534 |
| Gene description: | ets variant 1 |
| Genbank accession: | NM_004956 |
| Immunogen: | ETV1 (NP_004947, 148 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIK |
| Protein accession: | NP_004947 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ETV1 is 0.1 ng/ml as a capture antibody. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |