ETV1 monoclonal antibody (M01), clone 2A8 View larger

ETV1 monoclonal antibody (M01), clone 2A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ETV1 monoclonal antibody (M01), clone 2A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about ETV1 monoclonal antibody (M01), clone 2A8

Brand: Abnova
Reference: H00002115-M01
Product name: ETV1 monoclonal antibody (M01), clone 2A8
Product description: Mouse monoclonal antibody raised against a partial recombinant ETV1.
Clone: 2A8
Isotype: IgG1 Kappa
Gene id: 2115
Gene name: ETV1
Gene alias: DKFZp781L0674|ER81|MGC104699|MGC120533|MGC120534
Gene description: ets variant 1
Genbank accession: NM_004956
Immunogen: ETV1 (NP_004947, 148 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIK
Protein accession: NP_004947
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002115-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002115-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ETV1 is approximately 1ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ETV1 monoclonal antibody (M01), clone 2A8 now

Add to cart