Brand: | Abnova |
Reference: | H00002077-M02 |
Product name: | ERF monoclonal antibody (M02), clone 3F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ERF. |
Clone: | 3F11 |
Isotype: | IgG2b Kappa |
Gene id: | 2077 |
Gene name: | ERF |
Gene alias: | PE-2|PE2 |
Gene description: | Ets2 repressor factor |
Genbank accession: | BC022231 |
Immunogen: | ERF (AAH22231, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSG |
Protein accession: | AAH22231 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to ERF on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |