Cart 1 Product Products 106,27 € (empty)
No products
To be determined Shipping
106,27 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 106,27 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 106,27 €
Data sheet of EREG monoclonal antibody (M01), clone 1E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA |
More info about EREG monoclonal antibody (M01), clone 1E6
| Brand: | Abnova |
| Reference: | H00002069-M01 |
| Product name: | EREG monoclonal antibody (M01), clone 1E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EREG. |
| Clone: | 1E6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2069 |
| Gene name: | EREG |
| Gene alias: | ER |
| Gene description: | epiregulin |
| Genbank accession: | NM_001432 |
| Immunogen: | EREG (NP_001423, 32 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | STTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKE |
| Protein accession: | NP_001423 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged EREG is 0.1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |