ERCC2 monoclonal antibody (M09), clone 2C9 View larger

ERCC2 monoclonal antibody (M09), clone 2C9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERCC2 monoclonal antibody (M09), clone 2C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about ERCC2 monoclonal antibody (M09), clone 2C9

Brand: Abnova
Reference: H00002068-M09
Product name: ERCC2 monoclonal antibody (M09), clone 2C9
Product description: Mouse monoclonal antibody raised against a partial recombinant ERCC2.
Clone: 2C9
Isotype: IgG2b Kappa
Gene id: 2068
Gene name: ERCC2
Gene alias: COFS2|EM9|MGC102762|MGC126218|MGC126219|TTD|XPD
Gene description: excision repair cross-complementing rodent repair deficiency, complementation group 2
Genbank accession: NM_000400
Immunogen: ERCC2 (NP_000391, 631 a.a. ~ 730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHR
Protein accession: NP_000391
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002068-M09-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ERCC2 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy ERCC2 monoclonal antibody (M09), clone 2C9 now

Add to cart