| Brand: | Abnova |
| Reference: | H00002068-M04 |
| Product name: | ERCC2 monoclonal antibody (M04), clone S3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ERCC2. |
| Clone: | S3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2068 |
| Gene name: | ERCC2 |
| Gene alias: | COFS2|EM9|MGC102762|MGC126218|MGC126219|TTD|XPD |
| Gene description: | excision repair cross-complementing rodent repair deficiency, complementation group 2 |
| Genbank accession: | BC008346 |
| Immunogen: | ERCC2 (AAH08346, 1 a.a. ~ 405 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGQAQHCGSSRNQKRSHP |
| Protein accession: | AAH08346 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (70.29 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ERCC2 monoclonal antibody (M01), clone S3 Western Blot analysis of ERCC2 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |