Brand: | Abnova |
Reference: | H00002067-M01 |
Product name: | ERCC1 monoclonal antibody (M01), clone 3A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ERCC1. |
Clone: | 3A7 |
Isotype: | IgG2a Kappa |
Gene id: | 2067 |
Gene name: | ERCC1 |
Gene alias: | COFS4|UV20 |
Gene description: | excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) |
Genbank accession: | BC052813 |
Immunogen: | ERCC1 (AAH52813, 207 a.a. ~ 281 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGVGPQK |
Protein accession: | AAH52813 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ERCC1 is approximately 0.03ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |