ERBB3 monoclonal antibody (M04), clone 4G6 View larger

ERBB3 monoclonal antibody (M04), clone 4G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERBB3 monoclonal antibody (M04), clone 4G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ERBB3 monoclonal antibody (M04), clone 4G6

Brand: Abnova
Reference: H00002065-M04
Product name: ERBB3 monoclonal antibody (M04), clone 4G6
Product description: Mouse monoclonal antibody raised against a full length recombinant ERBB3.
Clone: 4G6
Isotype: IgG2b Kappa
Gene id: 2065
Gene name: ERBB3
Gene alias: ErbB-3|HER3|LCCS2|MDA-BF-1|MGC88033|c-erbB-3|c-erbB3|erbB3-S|p180-ErbB3|p45-sErbB3|p85-sErbB3
Gene description: v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
Genbank accession: BC002706
Immunogen: ERBB3 (AAH02706, 21 a.a. ~ 331 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF
Protein accession: AAH02706
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002065-M04-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ERBB3 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ERBB3 monoclonal antibody (M04), clone 4G6 now

Add to cart