Brand: | Abnova |
Reference: | H00002065-M03 |
Product name: | ERBB3 monoclonal antibody (M03), clone 2A4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ERBB3. |
Clone: | 2A4 |
Isotype: | IgG2b Kappa |
Gene id: | 2065 |
Gene name: | ERBB3 |
Gene alias: | ErbB-3|HER3|LCCS2|MDA-BF-1|MGC88033|c-erbB-3|c-erbB3|erbB3-S|p180-ErbB3|p45-sErbB3|p85-sErbB3 |
Gene description: | v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) |
Genbank accession: | BC002706 |
Immunogen: | ERBB3 (AAH02706, 21 a.a. ~ 331 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF |
Protein accession: | AAH02706 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ERBB3 is approximately 0.3ng/ml as a capture antibody. |
Applications: | IHC-P,S-ELISA,ELISA |
Shipping condition: | Dry Ice |