| Brand: | Abnova |
| Reference: | H00002065-M01 |
| Product name: | ERBB3 monoclonal antibody (M01), clone 2E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ERBB3. |
| Clone: | 2E9 |
| Isotype: | IgG1 kappa |
| Gene id: | 2065 |
| Gene name: | ERBB3 |
| Gene alias: | ErbB-3|HER3|LCCS2|MDA-BF-1|MGC88033|c-erbB-3|c-erbB3|erbB3-S|p180-ErbB3|p45-sErbB3|p85-sErbB3 |
| Gene description: | v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) |
| Genbank accession: | BC002706 |
| Immunogen: | ERBB3 (AAH02706, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHA |
| Protein accession: | AAH02706 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.04 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ERBB3 monoclonal antibody (M01), clone 2E9 Western Blot analysis of ERBB3 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |