ERBB2 monoclonal antibody (M06), clone 4B8 View larger

ERBB2 monoclonal antibody (M06), clone 4B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERBB2 monoclonal antibody (M06), clone 4B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ERBB2 monoclonal antibody (M06), clone 4B8

Brand: Abnova
Reference: H00002064-M06
Product name: ERBB2 monoclonal antibody (M06), clone 4B8
Product description: Mouse monoclonal antibody raised against a partial recombinant ERBB2.
Clone: 4B8
Isotype: IgG2b Kappa
Gene id: 2064
Gene name: ERBB2
Gene alias: CD340|HER-2|HER-2/neu|HER2|NEU|NGL|TKR1
Gene description: v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Genbank accession: NM_004448
Immunogen: ERBB2 (NP_004439, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD
Protein accession: NP_004439
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002064-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002064-M06-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged ERBB2 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ERBB2 monoclonal antibody (M06), clone 4B8 now

Add to cart