| Brand: | Abnova |
| Reference: | H00002064-M06 |
| Product name: | ERBB2 monoclonal antibody (M06), clone 4B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ERBB2. |
| Clone: | 4B8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2064 |
| Gene name: | ERBB2 |
| Gene alias: | CD340|HER-2|HER-2/neu|HER2|NEU|NGL|TKR1 |
| Gene description: | v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) |
| Genbank accession: | NM_004448 |
| Immunogen: | ERBB2 (NP_004439, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD |
| Protein accession: | NP_004439 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ERBB2 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |