ERBB2 monoclonal antibody (M04), clone 4E1 View larger

ERBB2 monoclonal antibody (M04), clone 4E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ERBB2 monoclonal antibody (M04), clone 4E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about ERBB2 monoclonal antibody (M04), clone 4E1

Brand: Abnova
Reference: H00002064-M04
Product name: ERBB2 monoclonal antibody (M04), clone 4E1
Product description: Mouse monoclonal antibody raised against a partial recombinant ERBB2.
Clone: 4E1
Isotype: IgG2b Kappa
Gene id: 2064
Gene name: ERBB2
Gene alias: CD340|HER-2|HER-2/neu|HER2|NEU|NGL|TKR1
Gene description: v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
Genbank accession: NM_004448
Immunogen: ERBB2 (NP_004439, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD
Protein accession: NP_004439
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002064-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002064-M04-3-31-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ERBB2 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ERBB2 monoclonal antibody (M04), clone 4E1 now

Add to cart