Brand: | Abnova |
Reference: | H00002057-M01 |
Product name: | EPOR monoclonal antibody (M01), clone 3D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EPOR. |
Clone: | 3D10 |
Isotype: | IgG2b Kappa |
Gene id: | 2057 |
Gene name: | EPOR |
Gene alias: | MGC138358 |
Gene description: | erythropoietin receptor |
Genbank accession: | NM_000121 |
Immunogen: | EPOR (NP_000112, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGA |
Protein accession: | NP_000112 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EPOR is approximately 0.03ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |