Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 238,90 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 238,90 €
Data sheet of EPO monoclonal antibody (M02), clone 1B12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about EPO monoclonal antibody (M02), clone 1B12
| Brand: | Abnova |
| Reference: | H00002056-M02 |
| Product name: | EPO monoclonal antibody (M02), clone 1B12 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant EPO. |
| Clone: | 1B12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2056 |
| Gene name: | EPO |
| Gene alias: | EP|MGC138142 |
| Gene description: | erythropoietin |
| Genbank accession: | NM_000799.2 |
| Immunogen: | EPO (NP_000790.2, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
| Protein accession: | NP_000790.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (47.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of EPO expression in transfected 293T cell line by EPO monoclonal antibody (M02), clone 1B12. Lane 1: EPO transfected lysate (Predicted MW: 21.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |