Cart 20 Product Products 5 851,43 € (empty)
No products
To be determined Shipping
5 851,43 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 20 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 851,43 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 851,43 €
Data sheet of EPO monoclonal antibody (M01), clone 4G7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Tr |
More info about EPO monoclonal antibody (M01), clone 4G7
| Brand: | Abnova |
| Reference: | H00002056-M01 |
| Product name: | EPO monoclonal antibody (M01), clone 4G7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant EPO. |
| Clone: | 4G7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2056 |
| Gene name: | EPO |
| Gene alias: | EP|MGC138142 |
| Gene description: | erythropoietin |
| Genbank accession: | NM_000799.1 |
| Immunogen: | EPO (NP_000790.1, 28 a.a. ~ 193 a.a) full-length recombinant protein. |
| Immunogen sequence/protein sequence: | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
| Protein accession: | NP_000790.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of EPO expression in transfected 293T cell line by EPO monoclonal antibody (M01), clone 4G7. Lane 1: EPO transfected lysate(21.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Immuno-magnetic beads-based extraction-capillary zone electrophoresis-deep UV laser-induced fluorescence analysis of erythropoietin.Wang H, Dou P, Lu C, Liu Z. J Chromatogr A. 2012 Jul 13;1246:48-54. |