EPO MaxPab mouse polyclonal antibody (B01) View larger

EPO MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EPO MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about EPO MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00002056-B01
Product name: EPO MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human EPO protein.
Gene id: 2056
Gene name: EPO
Gene alias: EP|MGC138142
Gene description: erythropoietin
Genbank accession: NM_000799
Immunogen: EPO (NP_000790, 1 a.a. ~ 193 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Protein accession: NP_000790
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002056-B01-13-15-1.jpg
Application image note: Western Blot analysis of EPO expression in transfected 293T cell line (H00002056-T01) by EPO MaxPab polyclonal antibody.

Lane 1: EPO transfected lysate(21.23 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EPO MaxPab mouse polyclonal antibody (B01) now

Add to cart