STX2 purified MaxPab mouse polyclonal antibody (B01P) View larger

STX2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STX2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about STX2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00002054-B01P
Product name: STX2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human STX2 protein.
Gene id: 2054
Gene name: STX2
Gene alias: EPIM|EPM|MGC51014|STX2A|STX2B|STX2C
Gene description: syntaxin 2
Genbank accession: NM_001980.2
Immunogen: STX2 (NP_001971.2, 1 a.a. ~ 287 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGIILATTLS
Protein accession: NP_001971.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002054-B01P-2-A0-1.jpg
Application image note: EPIM MaxPab polyclonal antibody. Western Blot analysis of EPIM expression in human kidney.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy STX2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart