| Brand:  | Abnova | 
| Reference:  | H00002048-M03 | 
| Product name:  | EPHB2 monoclonal antibody (M03), clone 4D1 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant EPHB2. | 
| Clone:  | 4D1 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 2048 | 
| Gene name:  | EPHB2 | 
| Gene alias:  | CAPB|DRT|EPHT3|ERK|Hek5|MGC87492|PCBC|Tyro5 | 
| Gene description:  | EPH receptor B2 | 
| Genbank accession:  | NM_017449 | 
| Immunogen:  | EPHB2 (NP_059145, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP | 
| Protein accession:  | NP_059145 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human,Mouse | 
| Application image:  |   | 
| Application image note:  | EPHB2 monoclonal antibody (M03), clone 4D1 Western Blot analysis of EPHB2 expression in NIH/3T3 ( Cat # L018V1 ). | 
| Applications:  | WB-Ce,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |