Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EPHB2 monoclonal antibody (M01A), clone 1F10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about EPHB2 monoclonal antibody (M01A), clone 1F10
| Brand: | Abnova |
| Reference: | H00002048-M01A |
| Product name: | EPHB2 monoclonal antibody (M01A), clone 1F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPHB2. |
| Clone: | 1F10 |
| Isotype: | IgM kappa |
| Gene id: | 2048 |
| Gene name: | EPHB2 |
| Gene alias: | CAPB|DRT|EPHT3|ERK|Hek5|MGC87492|PCBC|Tyro5 |
| Gene description: | EPH receptor B2 |
| Genbank accession: | NM_017449 |
| Immunogen: | EPHB2 (NP_059145, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP |
| Protein accession: | NP_059145 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |