Brand: | Abnova |
Reference: | H00002048-M01A |
Product name: | EPHB2 monoclonal antibody (M01A), clone 1F10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EPHB2. |
Clone: | 1F10 |
Isotype: | IgM kappa |
Gene id: | 2048 |
Gene name: | EPHB2 |
Gene alias: | CAPB|DRT|EPHT3|ERK|Hek5|MGC87492|PCBC|Tyro5 |
Gene description: | EPH receptor B2 |
Genbank accession: | NM_017449 |
Immunogen: | EPHB2 (NP_059145, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP |
Protein accession: | NP_059145 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |