| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | ELISA,WB-Re,WB-Tr | 
| Brand: | Abnova | 
| Reference: | H00002045-M01A | 
| Product name: | EPHA7 monoclonal antibody (M01A), clone 1G11 | 
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant EPHA7. | 
| Clone: | 1G11 | 
| Isotype: | IgM Kappa | 
| Gene id: | 2045 | 
| Gene name: | EPHA7 | 
| Gene alias: | EHK3|HEK11 | 
| Gene description: | EPH receptor A7 | 
| Genbank accession: | BC027940 | 
| Immunogen: | EPHA7 (AAH27940.1, 1 a.a. ~ 279 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK | 
| Protein accession: | AAH27940.1 | 
| Storage buffer: | In ascites fluid | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (56.32 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Western Blot analysis of EPHA7 expression in transfected 293T cell line by EPHA7 monoclonal antibody (M01A), clone 1G11. Lane 1: EPHA7 transfected lysate (Predicted MW: 31.8 KDa). Lane 2: Non-transfected lysate.  | 
| Applications: | ELISA,WB-Re,WB-Tr | 
| Shipping condition: | Dry Ice |