EPHA5 monoclonal antibody (M03), clone 6F4 View larger

EPHA5 monoclonal antibody (M03), clone 6F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EPHA5 monoclonal antibody (M03), clone 6F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about EPHA5 monoclonal antibody (M03), clone 6F4

Brand: Abnova
Reference: H00002044-M03
Product name: EPHA5 monoclonal antibody (M03), clone 6F4
Product description: Mouse monoclonal antibody raised against a partial recombinant EPHA5.
Clone: 6F4
Isotype: IgG1 Kappa
Gene id: 2044
Gene name: EPHA5
Gene alias: CEK7|EHK1|HEK7|TYRO4
Gene description: EPH receptor A5
Genbank accession: NM_004439
Immunogen: EPHA5 (NP_004430, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS
Protein accession: NP_004430
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002044-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EPHA5 monoclonal antibody (M03), clone 6F4 now

Add to cart