| Brand: | Abnova |
| Reference: | H00002042-M01 |
| Product name: | EPHA3 monoclonal antibody (M01), clone 3A12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPHA3. |
| Clone: | 3A12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2042 |
| Gene name: | EPHA3 |
| Gene alias: | ETK|ETK1|HEK|HEK4|TYRO4 |
| Gene description: | EPH receptor A3 |
| Genbank accession: | BC063282 |
| Immunogen: | EPHA3 (AAH63282, 202 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPP |
| Protein accession: | AAH63282 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.38 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of EPHA3 over-expressed 293 cell line, cotransfected with EPHA3 Validated Chimera RNAi ( Cat # H00002042-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with EPHA3 monoclonal antibody (M01) clone 3A12 (Cat # H00002042-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | EPHA3 regulates the multidrug resistance of small cell lung cancer via the PI3K/BMX/STAT3 sign.Peng J, Wang Q, Liu H, Ye M, Wu X, Guo L. Tumour Biol. 2016 Apr 21. [Epub ahead of print] |