| Brand:  | Abnova | 
| Reference:  | H00002042-M01 | 
| Product name:  | EPHA3 monoclonal antibody (M01), clone 3A12 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant EPHA3. | 
| Clone:  | 3A12 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 2042 | 
| Gene name:  | EPHA3 | 
| Gene alias:  | ETK|ETK1|HEK|HEK4|TYRO4 | 
| Gene description:  | EPH receptor A3 | 
| Genbank accession:  | BC063282 | 
| Immunogen:  | EPHA3 (AAH63282, 202 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | CPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPP | 
| Protein accession:  | AAH63282 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (39.38 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Western blot analysis of EPHA3 over-expressed 293 cell line, cotransfected with EPHA3 Validated Chimera RNAi ( Cat # H00002042-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with EPHA3 monoclonal antibody (M01) clone 3A12 (Cat # H00002042-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. | 
| Applications:  | WB-Ti,S-ELISA,ELISA,WB-Re,RNAi-Ab | 
| Shipping condition:  | Dry Ice | 
| Publications:  | EPHA3 regulates the multidrug resistance of small cell lung cancer via the PI3K/BMX/STAT3 sign.Peng J, Wang Q, Liu H, Ye M, Wu X, Guo L. Tumour Biol. 2016 Apr 21. [Epub ahead of print] |