Cart 31 Product Products 12 197,21 € (empty)
No products
To be determined Shipping
12 197,21 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 31 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 12 197,21 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 12 197,21 €
Data sheet of EPHA1 monoclonal antibody (M14), clone 8D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about EPHA1 monoclonal antibody (M14), clone 8D4
| Brand: | Abnova |
| Reference: | H00002041-M14 |
| Product name: | EPHA1 monoclonal antibody (M14), clone 8D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPHA1. |
| Clone: | 8D4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2041 |
| Gene name: | EPHA1 |
| Gene alias: | EPH|EPHT|EPHT1|MGC163163 |
| Gene description: | EPH receptor A1 |
| Genbank accession: | NM_005232 |
| Immunogen: | EPHA1 (NP_005223, 394 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDEERYQMVLEPR |
| Protein accession: | NP_005223 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged EPHA1 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |