| Brand: | Abnova |
| Reference: | H00002040-A01 |
| Product name: | STOM polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant STOM. |
| Gene id: | 2040 |
| Gene name: | STOM |
| Gene alias: | BND7|EPB7|EPB72 |
| Gene description: | stomatin |
| Genbank accession: | NM_004099 |
| Immunogen: | STOM (NP_004090, 59 a.a. ~ 142 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSA |
| Protein accession: | NP_004090 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | STOM polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of STOM expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |