Brand: | Abnova |
Reference: | H00002036-M09 |
Product name: | EPB41L1 monoclonal antibody (M09), clone 2D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EPB41L1. |
Clone: | 2D10 |
Isotype: | IgG2a Kappa |
Gene id: | 2036 |
Gene name: | EPB41L1 |
Gene alias: | 4.1N|DKFZp686H17242|KIAA0338|MGC11072 |
Gene description: | erythrocyte membrane protein band 4.1-like 1 |
Genbank accession: | NM_177996 |
Immunogen: | EPB41L1 (NP_818932, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKN |
Protein accession: | NP_818932 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EPB41L1 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |