| Brand: | Abnova |
| Reference: | H00002035-M01 |
| Product name: | EPB41 monoclonal antibody (M01), clone 3D9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPB41. |
| Clone: | 3D9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2035 |
| Gene name: | EPB41 |
| Gene alias: | 4.1R|EL1|HE |
| Gene description: | erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked) |
| Genbank accession: | BC039079 |
| Immunogen: | EPB41 (AAH39079, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECV |
| Protein accession: | AAH39079 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to EPB41 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |