Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EPB41 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about EPB41 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00002035-A01 |
| Product name: | EPB41 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant EPB41. |
| Gene id: | 2035 |
| Gene name: | EPB41 |
| Gene alias: | 4.1R|EL1|HE |
| Gene description: | erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked) |
| Genbank accession: | BC039079 |
| Immunogen: | EPB41 (AAH39079, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | IEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECV |
| Protein accession: | AAH39079 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Freely turning over palmitate in erythrocyte membrane proteins is not responsible for the anchoring of lipid rafts to the spectrin skeleton: A study with bio-orthogonal chemical probes.Ciana A, Achilli C, Hannoush RN, Risso A, Minetti G. Biochim Biophys Acta. 2012 Dec 3. pii: S0005-2736(12) 00420-8. doi: 10.1016/ j.bbamem.2012. 11.029 |