EP300 monoclonal antibody (M02), clone 1D2 View larger

EP300 monoclonal antibody (M02), clone 1D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EP300 monoclonal antibody (M02), clone 1D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about EP300 monoclonal antibody (M02), clone 1D2

Brand: Abnova
Reference: H00002033-M02
Product name: EP300 monoclonal antibody (M02), clone 1D2
Product description: Mouse monoclonal antibody raised against a partial recombinant EP300.
Clone: 1D2
Isotype: IgG1
Gene id: 2033
Gene name: EP300
Gene alias: KAT3B|p300
Gene description: E1A binding protein p300
Genbank accession: NM_001429
Immunogen: EP300 (NP_001420, 731 a.a. ~ 830 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN
Protein accession: NP_001420
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002033-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002033-M02-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to EP300 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EP300 monoclonal antibody (M02), clone 1D2 now

Add to cart