Cart 54 Product Products 20 047,20 € (empty)
No products
To be determined Shipping
20 047,20 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 54 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 20 047,20 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 20 047,20 €
Data sheet of EP300 monoclonal antibody (M01), clone 1B1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,ELISA,WB-Re |
More info about EP300 monoclonal antibody (M01), clone 1B1
| Brand: | Abnova |
| Reference: | H00002033-M01 |
| Product name: | EP300 monoclonal antibody (M01), clone 1B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EP300. |
| Clone: | 1B1 |
| Isotype: | IgG1 |
| Gene id: | 2033 |
| Gene name: | EP300 |
| Gene alias: | KAT3B|p300 |
| Gene description: | E1A binding protein p300 |
| Genbank accession: | NM_001429 |
| Immunogen: | EP300 (NP_001420, 731 a.a. ~ 830 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN |
| Protein accession: | NP_001420 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to EP300 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | p300 alters keratinocyte cell growth and differentiation through regulation of p21(Waf1/CIP1).Wong PP, Pickard A, McCance DJ. PLoS One. 2010 Jan 13;5(1):e8369. |