Brand: | Abnova |
Reference: | H00002027-M01A |
Product name: | ENO3 monoclonal antibody (M01A), clone 5D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ENO3. |
Clone: | 5D1 |
Isotype: | IgG2a Kappa |
Gene id: | 2027 |
Gene name: | ENO3 |
Gene alias: | MSE |
Gene description: | enolase 3 (beta, muscle) |
Genbank accession: | NM_001976 |
Immunogen: | ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG |
Protein accession: | NP_001967 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.24 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ENO3 monoclonal antibody (M01A), clone 5D1 Western Blot analysis of ENO3 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |