No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00002027-M01 |
Product name: | ENO3 monoclonal antibody (M01), clone 5D1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ENO3. |
Clone: | 5D1 |
Isotype: | IgG2a Kappa |
Gene id: | 2027 |
Gene name: | ENO3 |
Gene alias: | MSE |
Gene description: | enolase 3 (beta, muscle) |
Genbank accession: | NM_001976 |
Immunogen: | ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG |
Protein accession: | NP_001967 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (31.24 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | Reverse phase protein arrays for the identification/validation of biomarkers of beef texture and their use for early classification of carcasses.Gagaoua M, Bonnet M, Ellies-Oury MP, De Koning L, Picard B. Food Chem. 2018 Jun 1;250:245-252. doi: 10.1016/j.foodchem.2018.01.070. Epub 2018 Jan 10. |