Cart 28 Product Products 10 963,00 € (empty)
No products
To be determined Shipping
10 963,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 28 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 10 963,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 10 963,00 €
Data sheet of EN1 monoclonal antibody (M10), clone 3G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about EN1 monoclonal antibody (M10), clone 3G9
| Brand: | Abnova |
| Reference: | H00002019-M10 |
| Product name: | EN1 monoclonal antibody (M10), clone 3G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EN1. |
| Clone: | 3G9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2019 |
| Gene name: | EN1 |
| Gene alias: | - |
| Gene description: | engrailed homeobox 1 |
| Genbank accession: | NM_001426 |
| Immunogen: | EN1 (NP_001417, 266 a.a. ~ 392 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE* |
| Protein accession: | NP_001417 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EN1 monoclonal antibody (M10), clone 3G9. Western Blot analysis of EN1 expression in Jurkat. (~50kD,J Biol Chem, Vol. 274, Issue 9, 6020-6026, February 26, 1999,http://www.jbc.org/cgi/content/full/274/9/6020) |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |