Brand: | Abnova |
Reference: | H00002019-M06 |
Product name: | EN1 monoclonal antibody (M06), clone 1F5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant EN1. |
Clone: | 1F5 |
Isotype: | IgG2a Kappa |
Gene id: | 2019 |
Gene name: | EN1 |
Gene alias: | - |
Gene description: | engrailed homeobox 1 |
Genbank accession: | NM_001426 |
Immunogen: | EN1 (NP_001417, 266 a.a. ~ 392 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE* |
Protein accession: | NP_001417 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (40.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EN1 is approximately 1ng/ml as a capture antibody. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |