Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EN1 monoclonal antibody (M04), clone 3H2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about EN1 monoclonal antibody (M04), clone 3H2
| Brand: | Abnova |
| Reference: | H00002019-M04 |
| Product name: | EN1 monoclonal antibody (M04), clone 3H2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant EN1. |
| Clone: | 3H2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2019 |
| Gene name: | EN1 |
| Gene alias: | - |
| Gene description: | engrailed homeobox 1 |
| Genbank accession: | NM_001426 |
| Immunogen: | EN1 (NP_001417, 266 a.a. ~ 392 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE* |
| Protein accession: | NP_001417 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged EN1 is approximately 1ng/ml as a capture antibody. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Specification of dopaminergic subsets involves interplay of En1 and Pitx3.Veenvliet JV, Dos Santos MT, Kouwenhoven WM, von Oerthel L, Lim JL, van der Linden AJ, Koerkamp MJ, Holstege FC, Smidt MP Development. 2013 Aug;140(16):3373-84. doi: 10.1242/dev.094565. Epub 2013 Jul 17. |