EN1 monoclonal antibody (M02), clone 3E5 View larger

EN1 monoclonal antibody (M02), clone 3E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EN1 monoclonal antibody (M02), clone 3E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about EN1 monoclonal antibody (M02), clone 3E5

Brand: Abnova
Reference: H00002019-M02
Product name: EN1 monoclonal antibody (M02), clone 3E5
Product description: Mouse monoclonal antibody raised against a full length recombinant EN1.
Clone: 3E5
Isotype: IgG2a Kappa
Gene id: 2019
Gene name: EN1
Gene alias: -
Gene description: engrailed homeobox 1
Genbank accession: NM_001426
Immunogen: EN1 (NP_001417, 266 a.a. ~ 392 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE*
Protein accession: NP_001417
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002019-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged EN1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy EN1 monoclonal antibody (M02), clone 3E5 now

Add to cart