Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EMX2 monoclonal antibody (M06), clone 4F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,ELISA |
More info about EMX2 monoclonal antibody (M06), clone 4F7
| Brand: | Abnova |
| Reference: | H00002018-M06 |
| Product name: | EMX2 monoclonal antibody (M06), clone 4F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EMX2. |
| Clone: | 4F7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 2018 |
| Gene name: | EMX2 |
| Gene alias: | - |
| Gene description: | empty spiracles homeobox 2 |
| Genbank accession: | NM_004098 |
| Immunogen: | EMX2 (NP_004089, 103 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV |
| Protein accession: | NP_004089 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to EMX2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Emx2 expression levels in NSCs modulate astrogenesis rates by regulating EgfR and Fgf9.Falcone C, Filippis C, Granzotto M, Mallamaci A Glia. 2014 Oct 18. doi: 10.1002/glia.22761. |