EMX2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

EMX2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EMX2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about EMX2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00002018-D01P
Product name: EMX2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human EMX2 protein.
Gene id: 2018
Gene name: EMX2
Gene alias: -
Gene description: empty spiracles homeobox 2
Genbank accession: NM_004098.3
Immunogen: EMX2 (NP_004089.1, 1 a.a. ~ 252 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD
Protein accession: NP_004089.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00002018-D01P-2-C2-1.jpg
Application image note: EMX2 MaxPab rabbit polyclonal antibody. Western Blot analysis of EMX2 expression in mouse liver.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EMX2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart