| Brand:  | Abnova | 
| Reference:  | H00002017-M01 | 
| Product name:  | CTTN monoclonal antibody (M01), clone 2B5 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant CTTN. | 
| Clone:  | 2B5 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 2017 | 
| Gene name:  | CTTN | 
| Gene alias:  | EMS1|FLJ34459 | 
| Gene description:  | cortactin | 
| Genbank accession:  | NM_005231 | 
| Immunogen:  | CTTN (NP_005222.2, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | EAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEA | 
| Protein accession:  | NP_005222.2 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (37.84 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Proximity Ligation Analysis of protein-protein interactions between SYK and CTTN. HeLa cells were stained with anti-SYK rabbit purified polyclonal 1:1200 and anti-CTTN mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). | 
| Applications:  | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce | 
| Shipping condition:  | Dry Ice |