| Brand: | Abnova |
| Reference: | H00002011-M01 |
| Product name: | MARK2 monoclonal antibody (M01), clone 3B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MARK2. |
| Clone: | 3B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 2011 |
| Gene name: | MARK2 |
| Gene alias: | EMK1|MGC99619|PAR-1|Par1b |
| Gene description: | MAP/microtubule affinity-regulating kinase 2 |
| Genbank accession: | BC008771 |
| Immunogen: | MARK2 (AAH08771, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPG |
| Protein accession: | AAH08771 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MARK2 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Pancreatic LKB1 deletion leads to acinar polarity defects and cystic neoplasms.Hezel AF, Gurumurthy S, Granot Z, Swisa A, Chu GC, Bailey G, Dor Y, Bardeesy N, Depinho RA. Mol Cell Biol. 2008 Apr;28(7):2414-25. Epub 2008 Jan 28. |