EML1 monoclonal antibody (M01A), clone 5G3 View larger

EML1 monoclonal antibody (M01A), clone 5G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EML1 monoclonal antibody (M01A), clone 5G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about EML1 monoclonal antibody (M01A), clone 5G3

Brand: Abnova
Reference: H00002009-M01A
Product name: EML1 monoclonal antibody (M01A), clone 5G3
Product description: Mouse monoclonal antibody raised against a partial recombinant EML1.
Clone: 5G3
Isotype: IgM Kappa
Gene id: 2009
Gene name: EML1
Gene alias: ELP79|EMAP|EMAPL|FLJ45033|HuEMAP
Gene description: echinoderm microtubule associated protein like 1
Genbank accession: NM_001008707
Immunogen: EML1 (NP_001008707, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEDGFSSYSSLYDTSSLLQFCNDDSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLMQTLPLRTTVNN
Protein accession: NP_001008707
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002009-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002009-M01A-1-12-1.jpg
Application image note: EML1 monoclonal antibody (M01A), clone 5G3 Western Blot analysis of EML1 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EML1 monoclonal antibody (M01A), clone 5G3 now

Add to cart